PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa07g054650.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 848aa    MW: 95933.4 Da    PI: 8.8831
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa07g054650.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B333.48e-1121911293
                    HTT-EE--HHH.HTT...---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
              B3 12 ksgrlvlpkkfaeeh...ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93
                     ++ +++p +f++++   g++     +++  d s r+W+vk+  ++++    +t+GW+eF  an  + gD+v+ +++g+s f  +
  Csa07g054650.1 21 HTH-FTIPEDFFSKYverGSV----AEVK-SDVSDRTWQVKM--SGRR----FTDGWEEFTVANYFRIGDVVLVRYVGDSVF--H 91
                    444.9********99543222....2455.77999*******..7776....9************************99888..4 PP

2B345.31.5e-141752461796
                     E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3  17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                     vl  + a       ++ ++++l+d + rsW + l ++ +s+++++++GW++F+++ng k+g f++F+l+g +++++v+++
  Csa07g054650.1 175 VLRENSA-------RKFREIVLTDGKERSWALDLGFDESSDTFYISRGWRSFCDENGQKAGGFFMFQLVG-NGETPVLSL 246
                     3333333.......34458*************************************************99.555577766 PP

3B3512.6e-16322402186
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                     f+k ++p+++ k g l+l  +f++e+g++k++  ++ l d++gr+W  +l    ++g++ l+kGWk+FvkangL++g +  +kl++
  Csa07g054650.1 322 FIKFTLPPYYDKIGKLSLAAPFVRENGINKPG--EIFLLDKDGRRWLTNL-LLDCRGTMALGKGWKDFVKANGLESGFT--LKLIW 402
                     89999**********************99766..8***************.577777899****************955..44446 PP

4B359.17.8e-19476569198
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     f++ ++++++ ++++l+l+ kf++ +++k+     +tl  ++g + + +l  +k+sgr  ++kGWk+Fvk+ngLk+gD++++kl + +e+++v++
  Csa07g054650.1 476 FVTLTITPYSVERSILRLSMKFTRMNDIKPGI---VTLLGKNGIKHQTNLLLDKTSGRLAFGKGWKDFVKDNGLKTGDTFTLKLLW-EEQTPVFS 566
                     788899*****************999988765...***************99**********************************.77779999 PP

                     EE- CS
              B3  96 vfr 98 
                     ++ 
  Csa07g054650.1 567 LCP 569
                     996 PP

5B366.34.6e-21631723399
                     EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTE.EEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgr.yvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                     + +++++  k++rlvl+ +fa++++++k++  t+ l d++g +W  kl  ++ s + + l++GWkeF+kan+ k+gD+++ +l++ +++++++++
  Csa07g054650.1 631 TLTITPSGVKNCRLVLSAQFARDNNINKPG--TIYLLDTDGTKWLTKL--QRDSIGkMSLGEGWKEFAKANDFKQGDSFTMELIW-EDTTPMLSL 720
                     56789999****************999766..8***************..555555599**************************.888899999 PP

                     E-S CS
              B3  97 frk 99 
                     +rk
  Csa07g054650.1 721 LRK 723
                     987 PP

6B352.21.1e-16757844496
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                     +ltp+dv +s+ l+lp +f++++g++     ++tl +e+g +W+ +l    ++g++ l+ GWk+F++ang+++g+ +++++++++ +++v+k+
  Csa07g054650.1 757 ALTPEDVKASK-LILPSQFMKANGINRL--GKITLLTENGMEWSGYL--LTRDGTVALGCGWKGFCEANGVQVGEPFTLEFINKQYTTPVLKF 844
                     58999999998.***********99844..48***************..99999**************************9987777787776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.109.0E-15797IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.16E-149103IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.588998IPR003340B3 DNA binding domain
CDDcd100171.66E-91093No hitNo description
SMARTSM010196.1E-151298IPR003340B3 DNA binding domain
SMARTSM010191.2E-12166250IPR003340B3 DNA binding domain
CDDcd100173.01E-9167248No hitNo description
PfamPF023622.1E-12176246IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.5E-11177246IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.94E-13180249IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.069185249IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.5E-15314412IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019368.04E-16315412IPR015300DNA-binding pseudobarrel domain
CDDcd100174.54E-14320413No hitNo description
SMARTSM010191.2E-22322415IPR003340B3 DNA binding domain
PfamPF023623.7E-14322412IPR003340B3 DNA binding domain
PROSITE profilePS5086312.562322415IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.1E-18466575IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.1E-20472574IPR015300DNA-binding pseudobarrel domain
CDDcd100179.90E-17476569No hitNo description
SMARTSM010199.2E-26476571IPR003340B3 DNA binding domain
PfamPF023621.2E-17476570IPR003340B3 DNA binding domain
PROSITE profilePS5086312.083476571IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.7E-25619723IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.35E-21625723IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.5E-27629724IPR003340B3 DNA binding domain
PROSITE profilePS5086315.213629724IPR003340B3 DNA binding domain
CDDcd100172.04E-19629722No hitNo description
PfamPF023622.4E-19630723IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.5E-17748844IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.75E-18749844IPR015300DNA-binding pseudobarrel domain
SMARTSM010195.7E-17753847IPR003340B3 DNA binding domain
PROSITE profilePS5086313.155753847IPR003340B3 DNA binding domain
PfamPF023624.8E-15758844IPR003340B3 DNA binding domain
CDDcd100172.50E-12758835No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 848 aa     Download sequence    Send to blast
MATTSRVHHP QFFHTLVPGF HTHFTIPEDF FSKYVERGSV AEVKSDVSDR TWQVKMSGRR  60
FTDGWEEFTV ANYFRIGDVV LVRYVGDSVF HVSDLGPNHS EMQNNDEGKY LLKRRLHQVE  120
FSSNKGDVDV DDEELPREKR ARTNSEEAKA VSSSSSSSSA DDNSIFHYIS QDQIVLRENS  180
ARKFREIVLT DGKERSWALD LGFDESSDTF YISRGWRSFC DENGQKAGGF FMFQLVGNGE  240
TPVLSLYPTE SISDRRQRDC SEASKRESVA TKLSSVEENI AGEGSKDESS SPESLMDIEK  300
NKYILKPRGS PYSSYSPCHK RFIKFTLPPY YDKIGKLSLA APFVRENGIN KPGEIFLLDK  360
DGRRWLTNLL LDCRGTMALG KGWKDFVKAN GLESGFTLKL IWEETIPVLS LCCAESNNDR  420
ELEEFLKAIE KQSRFIDTSN RDKIKTNESK EKSRSWEKKK SHLKWRDSTP SSRKQFVTLT  480
ITPYSVERSI LRLSMKFTRM NDIKPGIVTL LGKNGIKHQT NLLLDKTSGR LAFGKGWKDF  540
VKDNGLKTGD TFTLKLLWEE QTPVFSLCPA ECSIGREAGG AATNQKKSLP IEPKTCKKIS  600
KDKNIKDDNG KEERRSVDRE RNQSSQKQYV TLTITPSGVK NCRLVLSAQF ARDNNINKPG  660
TIYLLDTDGT KWLTKLQRDS IGKMSLGEGW KEFAKANDFK QGDSFTMELI WEDTTPMLSL  720
LRKEFSSSKS NKEESIFSEP KNRDSSPTIE NRLVTLALTP EDVKASKLIL PSQFMKANGI  780
NRLGKITLLT ENGMEWSGYL LTRDGTVALG CGWKGFCEAN GVQVGEPFTL EFINKQYTTP  840
VLKFSSP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1457461KKKSH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010472478.10.0PREDICTED: B3 domain-containing protein REM13-like
SwissprotP0CAP50.0REM13_ARATH; B3 domain-containing protein REM13
TrEMBLV4NJI60.0V4NJI6_EUTSA; Uncharacterized protein
STRINGAT2G24650.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM137801326
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24650.10.0DNA binding;DNA binding;sequence-specific DNA binding transcription factors